PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009624441.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 308aa    MW: 34932.8 Da    PI: 5.6873
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009624441.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.21.2e-1792145356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  XP_009624441.1  92 KKRRLNLEQVKALERSFEVANKLEPERKIQLARALGLQPRQIAIWFQNRRARWK 145
                     4557899**********************************************9 PP

2HD-ZIP_I/II130.75.6e-4291182192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     ekkrrl+ eqvk+LE+sFe  +kLeperK +lar+Lglqprq+a+WFqnrRAR+ktkqlE+dye Lkr+ydalk++n++L++++++L++el+
  XP_009624441.1  91 EKKRRLNLEQVKALERSFEVANKLEPERKIQLARALGLQPRQIAIWFQNRRARWKTKQLERDYEILKRQYDALKSDNDALKTQNKNLHSELQ 182
                     69**************************************************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.41E-1989149IPR009057Homeodomain-like
SMARTSM003895.8E-1790151IPR001356Homeobox domain
PROSITE profilePS5007116.47191147IPR001356Homeobox domain
CDDcd000864.05E-1692148No hitNo description
PfamPF000466.7E-1592145IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.0E-1894154IPR009057Homeodomain-like
PRINTSPR000311.9E-5118127IPR000047Helix-turn-helix motif
PROSITE patternPS000270122145IPR017970Homeobox, conserved site
PRINTSPR000311.9E-5127143IPR000047Helix-turn-helix motif
PfamPF021832.9E-16147185IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MLSGITGIMA FVPSTPEISI NFQDNHIPST SPKVFPSPCN IPHQDFNGVS SMLMRRSMSF  60
SGVERCDNHQ DLRVDDNEMS DDDGSSQLLG EKKRRLNLEQ VKALERSFEV ANKLEPERKI  120
QLARALGLQP RQIAIWFQNR RARWKTKQLE RDYEILKRQY DALKSDNDAL KTQNKNLHSE  180
LQLLTLRNRE SGGGGAPMIN LNKENEGSWS NGSEENNSID VNIGTTTTTR TSSGDSPFYS  240
NNNKNNVFPE SSPIPLAQLF HQSSSRSDLQ CHTIDPTVPD DQGFCNMFAT PVNDQTNFWP  300
WPEQQQFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139147RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009624441.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13-like isoform X1
RefseqXP_016465587.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13-like
TrEMBLK4BBU01e-155K4BBU0_SOLLC; Uncharacterized protein
STRINGSolyc02g087840.2.11e-155(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8482498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-61HD-ZIP family protein